Protein Info for GFF1185 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: IncF plasmid conjugative transfer protein TraD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 747 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 108 to 134 (27 residues), see Phobius details TIGR02759: type IV conjugative transfer system coupling protein TraD" amino acids 8 to 577 (570 residues), 849.8 bits, see alignment E=5.8e-260 PF12615: TraD_N" amino acids 32 to 128 (97 residues), 126.5 bits, see alignment E=1.3e-40 PF10412: TrwB_AAD_bind" amino acids 173 to 561 (389 residues), 373.7 bits, see alignment E=2.1e-115 PF02534: T4SS-DNA_transf" amino acids 394 to 504 (111 residues), 37.3 bits, see alignment E=3.3e-13 PF12696: TraG-D_C" amino acids 419 to 541 (123 residues), 70.6 bits, see alignment E=2.4e-23

Best Hits

Swiss-Prot: 85% identical to TRAD2_ECOLX: Coupling protein TraD (traD) from Escherichia coli

KEGG orthology group: None (inferred from 99% identity to sei:SPC_p045)

Predicted SEED Role

"IncF plasmid conjugative transfer protein TraD" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (747 amino acids)

>GFF1185 IncF plasmid conjugative transfer protein TraD (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSFNAKDMTQGGQIASMRIRMFSQIANIIFYCLFIFFWILVGLVLWVKLSWQTFVNGGIY
WWCTTLEGMRDLIKSQPVYEIRYYGQTFRMNAAQVLQDKYTVWCGEQLWSAFVLAACVAL
VICLITFFMTTWILGRQGKQQSEDDVTGGRQLTDNPKDVARMLKKDGKASDILIGDLPII
KDSEIQNFLLHGTVSTGKSEIIRRLANYARQRGDMVVMYDRSCEFVKSYYDPSIDKILNP
CDARCAAWDLWRECLTLPDFDNAANTLIPMGTKEDPFWQGSGRTIFAEAAYLMRNDSDRS
YSKLVDTLLSIKIEKLRTYLRDSPAANLVEEKIEKTAISIRAVLTNYVKAVRYLQGIERN
GEPFTIRDWMRGVREDQKNGWLFISSNADTHSSLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEIVPEARKFGGCYVFGIQSSTQMEDIYGEKAAATLLDVMNTRA
FFRSPSYKIADYVAHEIGEKEILKASEQYSYGADPVRDGVSTGKEMERVTLVSYSDIQSL
PDLTCYVTLPGPYPAVKLALKYQERPKVAPEFIPREMNPEAEARLSAVLAAREAEVRQMS
SLFEPDTEAVAPTAAEAQAEQPQQPQQPQQPQQPQQPQQPQQPQQPQQPQQPQPTVVSDK
KSAAAGTAVNTPAGGVGQELKMKPEDEEQPLPPGINASGEVVDMAAYERWRQEQEVNTQQ
QMQRREEVNINVHRGHGKDEPEPGDDF