Protein Info for GFF1184 in Xanthobacter sp. DMC5

Annotation: Phosphatidyl-myo-inositol mannosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF13439: Glyco_transf_4" amino acids 18 to 124 (107 residues), 43.5 bits, see alignment E=7.2e-15 PF13579: Glyco_trans_4_4" amino acids 19 to 118 (100 residues), 30.9 bits, see alignment E=6.6e-11 PF00534: Glycos_transf_1" amino acids 169 to 304 (136 residues), 77.6 bits, see alignment E=1.7e-25 PF13692: Glyco_trans_1_4" amino acids 173 to 300 (128 residues), 61.8 bits, see alignment E=1.8e-20

Best Hits

KEGG orthology group: None (inferred from 78% identity to xau:Xaut_2712)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>GFF1184 Phosphatidyl-myo-inositol mannosyltransferase (Xanthobacter sp. DMC5)
MRIAQVAPLIESVPPRRYGGTERIVSYLTEELVAQGHDVTLFASGDSLTSAQLEPMCETG
LRLSTGPVDPVVFHLLMLEQVRRRADEFDLIHVHVDVLHYPVLKELAPRTLTTLHGRLDS
VAAQRLYALYDEFPLVSISNHQRKPMPPVNWASTIYHGLPEALLPFNPTGGDYLAFLGRI
SPEKRPDRAIEIAARAGLPLKIAAKVDQADLEYWETKIRPMVEATPGVEFIGEIDERQKA
QFLGNAKALIFPIDWPEPFGLVMIEAMSCGTPTIAYGCGSVPEVLENGLTGYIVRSQDEA
VARVADLDRLDRAAIRRTFEKRFSATRMARDYVALYERLAAPSSPRMVPRELVNGSLNVA
V