Protein Info for GFF1182 in Xanthobacter sp. DMC5

Annotation: putative protein YisK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details PF10370: Rv2993c-like_N" amino acids 1 to 62 (62 residues), 28.7 bits, see alignment E=2.1e-10 PF01557: FAA_hydrolase" amino acids 68 to 274 (207 residues), 251.1 bits, see alignment E=9.4e-79

Best Hits

KEGG orthology group: None (inferred from 56% identity to npp:PP1Y_Mpl8977)

MetaCyc: 49% identical to DntG (Burkholderia cepacia R34)
5.3.2.-; 3.7.1.-

Predicted SEED Role

"Fumarylacetoacetate hydrolase family protein" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>GFF1182 putative protein YisK (Xanthobacter sp. DMC5)
MRIVRFEHQGRIQFGTRRDDHVTPFAGVAGGSFTALLAALADGAHVPQATPIPEAQVSLL
PPVPLTGKIICIGLNYADHAREGGHPIPTYPAVFLRTATSLVGHGQPLVRPALSERFDYE
AELAVVIGRTAHRVRAADALHHVAGYSCFNDGSIRDFQRKSTQWTMGKNFDRSGSVGPEL
VTPDELPSGVDNLRITARLNGETLQDGSTREMIFPVADLIETLSAVMTLEPGDVIATGTP
AGVGFARTPPRFMEAGDLIEIEIEGIGILANTIVDEAPDAAEQESHRP