Protein Info for PS417_06000 in Pseudomonas simiae WCS417

Annotation: peptide chain release factor 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 TIGR00020: peptide chain release factor 2" amino acids 2 to 291 (290 residues), 465.9 bits, see alignment E=4.2e-144 PF03462: PCRF" amino acids 14 to 148 (135 residues), 149.4 bits, see alignment E=1.1e-47 PF00472: RF-1" amino acids 156 to 265 (110 residues), 146.4 bits, see alignment E=3.5e-47

Best Hits

Swiss-Prot: 70% identical to RF2_SALPA: Peptide chain release factor 2 (prfB) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K02836, peptide chain release factor 2 (inferred from 99% identity to pfl:PFL_1137)

Predicted SEED Role

"Peptide chain release factor 2; programmed frameshift-containing"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TVC5 at UniProt or InterPro

Protein Sequence (293 amino acids)

>PS417_06000 peptide chain release factor 2 (Pseudomonas simiae WCS417)
MNTGLADCRDLLDMAVEENDEGAVGDVVAELARLEENLAKLEFRRMFSHEMDPNNAYLDI
QAGSGGTEAQDWANILLRMYLRWADKRGFEATIMELSAGEVAGIKGATVHIKGEYAFGWL
RTEIGVHRLVRKSPFDSGNRRHTSFSAVFVSPEIDDKVEIEINPADLRIDTYRSSGAGGQ
HVNTTDSAVRITHVPTNTVVSCQNERSQHANKDTAMKMLRAKLYEQEMQKRNAASQALED
TKSDIGWGHQIRSYVLDASRIKDLRTNIERSDCDKVLDGDIDEYLEASLKSGL