Protein Info for GFF1180 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 58 to 78 (21 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 111 to 128 (18 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 163 to 186 (24 residues), see Phobius details TIGR03902: rhombosortase" amino acids 34 to 184 (151 residues), 131.7 bits, see alignment E=1.1e-42 PF01694: Rhomboid" amino acids 45 to 180 (136 residues), 53.3 bits, see alignment E=1.7e-18

Best Hits

KEGG orthology group: None (inferred from 47% identity to put:PT7_1134)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (194 amino acids)

>GFF1180 membrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
VSRPSPTHRRTWLAIAALIAAMAVLQALPAGARATLRFERAALLDGELWRLFTAHLVHLG
WAHWALNALGLVLCGVLANPLPSPGRLLACVAGLGLGVSLMLLAFDPSLTHYVGLSGVLY
GLFVLTLWPQARRGDGLGRVALATVLAWMAWQWAVGPVASEAALIGGAIVAQAHAYGVAA
AAGLLVMERHLKWE