Protein Info for GFF1177 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: IncF plasmid conjugative transfer pilus assembly protein TraF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02739: type-F conjugative transfer system pilin assembly protein TraF" amino acids 11 to 249 (239 residues), 310.4 bits, see alignment E=4.3e-97 PF13728: TraF" amino acids 26 to 240 (215 residues), 230.8 bits, see alignment E=9.5e-73

Best Hits

Swiss-Prot: 86% identical to TRAF_ECOLI: Protein TraF (traF) from Escherichia coli (strain K12)

KEGG orthology group: K12057, conjugal transfer pilus assembly protein TraF (inferred from 100% identity to stm:PSLT097)

Predicted SEED Role

"IncF plasmid conjugative transfer pilus assembly protein TraF" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>GFF1177 IncF plasmid conjugative transfer pilus assembly protein TraF (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MMRKIQTVWVAALLCGSLTAYGKDAGWQWYNDPVKLPDPKTTDKSAQVRQEPDIMQKLSA
LQTATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFSMSAKKAMLAHPELDYNLQYSH
YNGTVRNQLAADQAQQRQAISKLAEHYGIMFFYRGQDPIDGQLAQVINGFRATYGLSVIP
VTVDGVINPMLPDTRPDQGQAQRLGVKYFPAMMLVDPKQGSVRPLSYGFITQDDLAKQFL
NVSEDFKPNF