Protein Info for PS417_05930 in Pseudomonas simiae WCS417

Annotation: spermidine/putrescine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 83 to 107 (25 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 225 to 249 (25 residues), see Phobius details amino acids 253 to 254 (2 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 102 to 302 (201 residues), 46.8 bits, see alignment E=1.5e-16

Best Hits

Swiss-Prot: 78% identical to YDCU_ECOLI: Inner membrane ABC transporter permease protein YdcU (ydcU) from Escherichia coli (strain K12)

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 99% identity to pfs:PFLU1211)

MetaCyc: 78% identical to putative ABC transporter membrane subunit YdcU (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYN9 at UniProt or InterPro

Protein Sequence (309 amino acids)

>PS417_05930 spermidine/putrescine ABC transporter permease (Pseudomonas simiae WCS417)
MSLALSQPPMRRFSNLLYRKPNLYLAMLLVPPLIWFGAIYLGSLLTLLWQGFYTFDDFTM
AVTPDLTLANFAALFQPSNFDIIVRTLSMAIAVSIASAIVAFPIAYYMARYTTGKTKAFF
YIAVMMPMWASYIVKAYAWTLLLAKGGVAQWFVQHLGLEPVLQFVLGIPGVGGSTLSTSH
LGRFMVFVYIWLPFMILPIQASLERLPPSLLQASADLGAKPRQTFMQVILPLSIPGIAAG
SIFTFSLTLGDFIVPQLVGPPGYFVGGMVYAQQGAIGNMPMAAAFTLVPIVLIAVYLSIV
KRLGAFDAL