Protein Info for PS417_05925 in Pseudomonas simiae WCS417

Annotation: spermidine/putrescine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 188 to 212 (25 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 80 to 248 (169 residues), 42.3 bits, see alignment E=3.5e-15

Best Hits

Swiss-Prot: 78% identical to YDCV_SHIFL: Inner membrane ABC transporter permease protein YdcV (ydcV) from Shigella flexneri

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to pfs:PFLU1210)

MetaCyc: 78% identical to putative ABC transporter membrane subunit YdcV (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U2X3 at UniProt or InterPro

Protein Sequence (269 amino acids)

>PS417_05925 spermidine/putrescine ABC transporter permease (Pseudomonas simiae WCS417)
MHSEKSSMSLKIAAWGGLVFLHFPILIIFLYAFNTEEAAFSFPPQGFTLKWFSVAFARPD
VLEAIKLSLQIAAIATLIAMVLGTLASAALYRREFFGKQGVSLMLILPIALPGIITGIAL
LATFKTLGIEPGMFTIIVGHATFCVVIVYNNVIARLRRTSHSLIEASMDLGADGWQTFRY
IIMPNLGSALLAGGMLAFALSFDEIIVTTFTAGHERTLPLWLLNQLSRPRDVPVTNVVAM
LVMLVTMFPILGAYYLTRGGESVAGSGGK