Protein Info for GFF1164 in Xanthobacter sp. DMC5

Annotation: tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF00588: SpoU_methylase" amino acids 18 to 168 (151 residues), 90.2 bits, see alignment E=7e-30 TIGR00050: RNA methyltransferase, TrmH family, group 1" amino acids 19 to 250 (232 residues), 175.3 bits, see alignment E=9.6e-56

Best Hits

KEGG orthology group: K02533, tRNA/rRNA methyltransferase [EC: 2.1.1.-] (inferred from 82% identity to xau:Xaut_4570)

Predicted SEED Role

"tRNA:Cm32/Um32 methyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>GFF1164 tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ (Xanthobacter sp. DMC5)
MPGSGTDSTKPWTAGGPLIILVEPQLGDNIGSAARAMGNFGLSRLRIVNPRQGWPNDRAR
TFAAGADRILDEAQLFPDLRAALHDVKFAFATTARERGMAKRVVGADEATAEARSRMAAG
EEVALVFGRERTGLYTEEVSLCDAILTLPVNPAFASLNLATCVAVAGYEWSKAESGGALP
FAPPDRSPLADKGDLFAFFDHLETALQTSGFFRSPEKAPSTIRNLRNIFHRLGLTRQDLA
TLHGAVTALEEGREGREARKAENNARAAARKAGGGTTGSGEGGDAG