Protein Info for PS417_05895 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 54 to 80 (27 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details amino acids 281 to 303 (23 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details amino acids 339 to 358 (20 residues), see Phobius details PF04235: DUF418" amino acids 220 to 380 (161 residues), 124.9 bits, see alignment E=1.6e-40

Best Hits

KEGG orthology group: K07148, uncharacterized protein (inferred from 60% identity to pfl:PFL_1124)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TVB6 at UniProt or InterPro

Protein Sequence (389 amino acids)

>PS417_05895 membrane protein (Pseudomonas simiae WCS417)
MTPTRLVHVDALRGFALFGILAVNICAFADPYYASTLSNPDYAGTVDHVVRFVISLLFET
KFYLLFSFLFGYSFTLQMAAAERANAAFAPRMVRRQLALLALGLAHGAALYYGEILSTYA
LLGLVLLAARNLSPAKAYRWGICLVVTACSAWMLLGVLQALEGNLTGVSSPDAADKLVAF
TGSAVDTLRFHSGHLWSTVQALWLLQGPSALAMFFFGYAAGRRQLLVSPYAWQPRLSRLL
LITLPAGLLGAMIYALSAAYAPGGGLETFAFGVGQLTAPLLSAAYALLMLALFSSAAGPW
LCHWLAPVGKMALSNYLLQSVLLGLLFSGYGAGLINTLAPLLMLPVALGIFALQLWLSAR
WLRTHPYGPMEWLLRAATLWAWPNWRRTA