Protein Info for GFF116 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Porphobilinogen deaminase (EC 2.5.1.61)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 TIGR00212: hydroxymethylbilane synthase" amino acids 10 to 308 (299 residues), 311.5 bits, see alignment E=2.3e-97 PF01379: Porphobil_deam" amino acids 10 to 219 (210 residues), 263.1 bits, see alignment E=1.6e-82 PF03900: Porphobil_deamC" amino acids 232 to 307 (76 residues), 46.8 bits, see alignment E=3.3e-16

Best Hits

Swiss-Prot: 73% identical to HEM3_RHOFT: Porphobilinogen deaminase (hemC) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K01749, hydroxymethylbilane synthase [EC: 2.5.1.61] (inferred from 75% identity to vpe:Varpa_1513)

Predicted SEED Role

"Porphobilinogen deaminase (EC 2.5.1.61)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.5.1.61)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>GFF116 Porphobilinogen deaminase (EC 2.5.1.61) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSPSSSPLAITIATRESRLALWQAEHVKALLEGLGHRVTLLGMTTLGDQILDRSLSKVGG
KGLFVKELELALEDGRADIAVHSLKDVPMELPPGFALACVMEREDPRDAWVSPHCAGLAD
LPANGVVGTSSLRRLVLLRAALNQLGRDDVRIEPLRGNLDTRLRKLDEGRYHAIVLAAAG
LKRLGLEARIRHIFEPVESLPAAGQGALGIEVRADRADLIAALAPLVHLPTWLRVAAERT
VSRAMGGSCSMPLAAYADWGREGALRLDAAWGDPEGQAPLVRVGQQSSVTTLDEAEALGQ
QVAQALRAAGAAPPAAET