Protein Info for GFF1159 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: IncF plasmid conjugative transfer pilus assembly protein TraB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details PF03743: TrbI" amino acids 211 to 407 (197 residues), 86.9 bits, see alignment E=8.3e-29

Best Hits

Swiss-Prot: 89% identical to TRAB1_ECOLI: Protein TraB (traB) from Escherichia coli (strain K12)

KEGG orthology group: K12065, conjugal transfer pilus assembly protein TraB (inferred from 100% identity to stm:PSLT081)

Predicted SEED Role

"IncF plasmid conjugative transfer pilus assembly protein TraB" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>GFF1159 IncF plasmid conjugative transfer pilus assembly protein TraB (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MASINTVVKRKQYIWLGIVAVGAAAAIGGGLYLSDVDMSGNGTAAEQEPVPDMTGVVDTT
FDDKVRQHATTEMQVTAAQMQKQYDEIRHELDVLNKQRGDDQRRIEKLGQDNAALAEQVK
ALGANPVTTTGEPVPHTPVSPPGPEGEPQPGNTPMTFPPQGAVPPPTAFYPGNGVTPPPQ
VTYQSVPVPNRIQRKTFSYDAAAKKGPSLPYIPSGSFAKTMLIEGADANASVTGNESTVP
MQLRITGPVEMPNSKTYDLTGCFVGLEAWGDVSSERAIVRTRNISCLKDGKTIDMSVKGH
VSFRGKNGIKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQQAVGLGATATYGAGDVFR
MGIGGGASKAAQTLSDYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTVEEMAQEQARH
RKEDENAESPVPIPPSVDSHMNGFNTDQMLKQLGDLNPQQFMSGSQGGHVNGK