Protein Info for GFF1155 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: IncF plasmid conjugative transfer pilin protein TraA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details PF05513: TraA" amino acids 1 to 118 (118 residues), 254.9 bits, see alignment E=4.7e-81 TIGR02758: type IV conjugative transfer system pilin TraA" amino acids 23 to 120 (98 residues), 138.8 bits, see alignment E=2.8e-45

Best Hits

Swiss-Prot: 89% identical to PIL6_ECOLX: Pilin (traA) from Escherichia coli

KEGG orthology group: None (inferred from 100% identity to stm:PSLT077)

Predicted SEED Role

"IncF plasmid conjugative transfer pilin protein TraA" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (120 amino acids)

>GFF1155 IncF plasmid conjugative transfer pilin protein TraA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSAILSVQGASAPVKKKSFLSTFTRLNLLKLARAVIPAAVLIFFFPQLAMAAGGSQDLMA
SGNGTVKATFGKDSSAVKWVILAEVLVGAVMYMMTKNVKFLAGFAIISVFIAVGMAVVGL