Protein Info for GFF1153 in Variovorax sp. SCN45

Annotation: Diacylglycerol kinase (EC 2.7.1.107)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 transmembrane" amino acids 46 to 63 (18 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details PF01219: DAGK_prokar" amino acids 31 to 128 (98 residues), 109.1 bits, see alignment E=4.5e-36

Best Hits

Swiss-Prot: 48% identical to KDGL_ECOLI: Diacylglycerol kinase (dgkA) from Escherichia coli (strain K12)

KEGG orthology group: K00901, diacylglycerol kinase [EC: 2.7.1.107] (inferred from 91% identity to vap:Vapar_2363)

MetaCyc: 48% identical to diacylglycerol kinase (Escherichia coli K-12 substr. MG1655)
Diacylglycerol kinase. [EC: 2.7.1.107]

Predicted SEED Role

"Diacylglycerol kinase (EC 2.7.1.107)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.1.107)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (135 amino acids)

>GFF1153 Diacylglycerol kinase (EC 2.7.1.107) (Variovorax sp. SCN45)
MSALPNLPDPAVNPQKARKGFERVWHATLISLHGLRAGWSEPAFRQEAILSIFMIPASFW
LGSSWVEVALLAGSALLVMIVELLNTAVEAAIDRIGPEWHDLSKRAKDMGSAAVLLSLTL
CGGIWAAALWQRFLS