Protein Info for GFF1152 in Variovorax sp. SCN45

Annotation: Lysine decarboxylase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 TIGR00730: TIGR00730 family protein" amino acids 6 to 180 (175 residues), 209.1 bits, see alignment E=2.1e-66 PF18306: LDcluster4" amino acids 13 to 118 (106 residues), 56.9 bits, see alignment E=2e-19 PF03641: Lysine_decarbox" amino acids 49 to 178 (130 residues), 146.8 bits, see alignment E=4.2e-47

Best Hits

Swiss-Prot: 52% identical to LOGH_PSEAE: Putative cytokinin riboside 5'-monophosphate phosphoribohydrolase (PA4923) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06966, (no description) (inferred from 94% identity to vpe:Varpa_2545)

Predicted SEED Role

"Lysine decarboxylase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>GFF1152 Lysine decarboxylase family (Variovorax sp. SCN45)
MNPEFSICVYCGSRPGERPEFSQAAQAVGQWIGKHGGQLVYGGGRTGLMGTVAEATRLAG
GRVVGIIPKALVDKELANSLCDELHVVDTMHERKAMMGERADAFVALPGGIGTFEELFEI
WTWRQLGYHDKPTGILNTAGYYDGLLGFLAHSVREGFMGEWQMELIRTGTEVPELLAALR
AEVPLHPREDRLSENL