Protein Info for GFF115 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 25 to 48 (24 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 15 to 111 (97 residues), 102.3 bits, see alignment E=8.9e-34 PF00528: BPD_transp_1" amino acids 39 to 216 (178 residues), 67.8 bits, see alignment E=5.2e-23

Best Hits

Swiss-Prot: 30% identical to GLNM_BACSU: Probable glutamine ABC transporter permease protein GlnM (glnM) from Bacillus subtilis (strain 168)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 64% identity to pao:Pat9b_4931)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>GFF115 ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines) (Variovorax sp. SCN45)
MAYQFQFDALAPYTGQLVEGLLHTLGYAASSIVLGMAIGVAGSLALVYGGKPLRGVTRVY
VEFFRNTPALVQLFLIYFGLPNLGIRLEAPVAGVISLALYCGAYMVEVFRSGLMSVPRGL
SEAGAALGLRPRQVLVHVLFVPALRNVFPSLASQMVLTLIGTSLISQIGVEDIFHAGSFI
DSRTFRSFEVYLVICAMYFVAVQALRVILGFVQRRLFGKEG