Protein Info for GFF1149 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Hydroxymethylpyrimidine ABC transporter, transmembrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 120 to 169 (50 residues), see Phobius details amino acids 196 to 221 (26 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 95 to 267 (173 residues), 75.3 bits, see alignment E=2.7e-25

Best Hits

Swiss-Prot: 30% identical to Y355_HAEIN: Probable ABC transporter permease protein HI_0355 (HI_0355) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 34% identity to rca:Rcas_0666)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>GFF1149 Hydroxymethylpyrimidine ABC transporter, transmembrane component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNTTTVTPPAVAPAPPAAAALTLLRRVLRIVSRIALPIVSILGLWYLAIAFSGLPEFVIP
RPTQVLAVLTQETSFVTQHLVVTLRAAAIGFLLANVVGIGLAVLFTSLPMFNRLLMPAAI
TIRNVPYVALASVLVLAVGDGLWTKVMIVTIAGFFPVLVNTMRGLAAVDTVVLDRMRILD
VSPWKVFLKVRLPYSVPYILAAQEITGSGSIIVAVAAEWMISSEGLGYVINRAMAQYRGD
QVYAVALLAAVLSYAIYMLVQLIGARINWSERSRNGGK