Protein Info for GFF1146 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: B12 binding domain of Methylmalonyl-CoA mutase (EC 5.4.99.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02310: B12-binding
  • amino acids 1 to 111 (111 residues), 80.8 bits, E=3.7e-27
• TIGR00640: methylmalonyl-CoA mutase C-terminal domain
  • amino acids 1 to 124 (124 residues), 131.1 bits, E=1.3e-42

Best Hits

Swiss-Prot: 68% identical to PCMB_XANP2: Pivalyl-CoA mutase small subunit (Xaut_5044) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K01849, methylmalonyl-CoA mutase, C-terminal domain [EC: 5.4.99.2] (inferred from 68% identity to xau:Xaut_5044)

MetaCyc: 49% identical to methylmalonyl-CoA mutase beta subunit (Metallosphaera sedula)

Predicted SEED Role

No annotation

MetaCyc Pathways

• propanoyl CoA degradation I (3/3 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• 2-oxobutanoate degradation I (3/4 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• conversion of succinate to propanoate (1/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• 3-hydroxypropanoate cycle (8/13 steps found)
• methylaspartate cycle (12/19 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• superpathway of L-methionine salvage and degradation (8/16 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)
• superpathway of the 3-hydroxypropanoate cycle (9/18 steps found)
• crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (3/14 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 5.4.99.2

Use Curated BLAST to search for 5.4.99.2

Protein Sequence (133 amino acids)

>GFF1146 B12 binding domain of Methylmalonyl-CoA mutase (EC 5.4.99.2) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VIVTKIGFDGHDRGSRVIAACLRDAGMEVIYTPPWQEIPTVVKLTMEEDADVIGISSLAT
DHLIVPKLMAALKEAGLSDVQVIVGGIVPAKDESTLLDCGVAQVFHPGTSLDDVVVSVRA
LSEKRRALLGAST