Protein Info for GFF1144 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 633 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 19 to 20 (2 residues), see Phobius details amino acids 29 to 49 (21 residues), see Phobius details amino acids 441 to 465 (25 residues), see Phobius details amino acids 481 to 503 (23 residues), see Phobius details amino acids 510 to 535 (26 residues), see Phobius details amino acids 541 to 561 (21 residues), see Phobius details amino acids 572 to 589 (18 residues), see Phobius details amino acids 595 to 617 (23 residues), see Phobius details TIGR03061: YhgE/Pip N-terminal domain" amino acids 20 to 174 (155 residues), 111.2 bits, see alignment E=6e-36 TIGR03062: YhgE/Pip C-terminal domain" amino acids 425 to 619 (195 residues), 128.6 bits, see alignment E=3.6e-41 PF12698: ABC2_membrane_3" amino acids 471 to 614 (144 residues), 32.3 bits, see alignment E=6.1e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (633 amino acids)

>GFF1144 hypothetical protein (Variovorax sp. SCN45)
MRYLRALIAGTLAIACAELAVVRRFPRILLAIVAVGVVPAIYALIYLTSVWDPAGHTADL
PAAIVNEDRGVTYMSHSVNVGEQLTATLLAKRAFGFRVMTNEEEARAEVRRGTLAFALLI
PPDFSADAVPGAQRGAGRLVVYTSEGNNYSSAGLARRFAGELGHQVNEMLNEQRWTLVLN
AAAGSQQRLEQLKQALLALRDGSQTLASGAAQYSTAAREVGNGFKQVNGGIRLIQSKLPA
DADLRALKSGAQQLAAGQHELGSGLVQIGEGLDQLHGGAGQLGDGARRLQRESADIPFVG
ERIARGAGELAGGADKLRGGLEQAQAAMSKTQDGNLKLTDGATALEGGVGKLTDGMGALS
AGIRTMAGKLPEDRRLDEFVQGGTQLAQGAQRLLTGVRTIEAALPASITRIQGSASGLAD
SVEPRVEVVAPVANNGSAFVPNMVSVALWIGAVMAGYLFNIRIVLSDHTHYPKLAKTLGK
ITVPALIVLLQVALVLATLLGVLEVQAPNVAALALTMALASLVFLVVLFAILHVFGDFGR
ILTVLLLTLQLSAGGGVLPVELSAGFFRTVHSWLPFSWVVQAFRAVMFGAFDNGWVHACG
VVLLSGAVAVGLMAIFGKWKDVLLADYKPTIQV