Protein Info for GFF1144 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: putative periplasmic protein kinase ArgK and related GTPases of G3E family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 TIGR00750: LAO/AO transport system ATPase" amino acids 15 to 243 (229 residues), 287 bits, see alignment E=1.5e-89 PF03308: MeaB" amino acids 21 to 243 (223 residues), 270.9 bits, see alignment E=2e-84 TIGR00369: uncharacterized domain 1" amino acids 273 to 386 (114 residues), 52.1 bits, see alignment E=6.5e-18 PF03061: 4HBT" amino acids 306 to 374 (69 residues), 27.6 bits, see alignment E=6e-10

Best Hits

Predicted SEED Role

"putative periplasmic protein kinase ArgK and related GTPases of G3E family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>GFF1144 putative periplasmic protein kinase ArgK and related GTPases of G3E family (Hydrogenophaga sp. GW460-11-11-14-LB1)
VIAVSNMSIQKVLAGDRRSIARAISALENGGETAYEVRRAIAASQGRAHVIGVTGPPGGG
KSTLVSSLIKGLRQKGRTVAVVAIDPSSPFTGGAVLGDRIRMGERQSDEGVFIRSLASRG
HLGGLSVAAGDVIDLFDASGFDVVIVETVGAGQSEVEITRFADTRLVVCPPGLGDDVQAI
KAGVLEIADLFVVTKADLPDARKTESELLAMLTLRRSQAEAPQVRCVSAPRDEGIDELVD
WLDARSERGRRHAAGGAKAAYNLVSRCIAGDNMARLLGIELVSASMGSTTLRMKVMRKHM
NFNDRCHGGALFALGDMALGLACNSHGKIATLVDGQLSISTAVEEGEWLVAHAYEVSRSR
KIGSYQVKITRARDDEHIALLHGTVYVLDRSVEPVAGEGA