Protein Info for PS417_05810 in Pseudomonas simiae WCS417

Annotation: damage-inducible protein CinA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02464: CinA
  • amino acids 5 to 156 (152 residues), 176 bits, E=2.2e-56
• TIGR00199: amidohydrolase, PncC family
  • amino acids 11 to 157 (147 residues), 145.9 bits, E=5e-47

Best Hits

Swiss-Prot: 76% identical to PNCC_PSEPU: Nicotinamide-nucleotide amidohydrolase PncC (pncC) from Pseudomonas putida

KEGG orthology group: K03743, (no description) (inferred from 94% identity to pfs:PFLU1188)

MetaCyc: 53% identical to NMN aminohydrolase (Escherichia coli K-12 substr. MG1655)
Nicotinamide-nucleotide amidase. [EC: 3.5.1.42]

Predicted SEED Role

"C-terminal domain of CinA type S; Protein Implicated in DNA repair function with RecA and MutS"

MetaCyc Pathways

• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.42

Sequence Analysis Tools

See A0A1N7UDQ6 at UniProt or InterPro

Protein Sequence (166 amino acids)

>PS417_05810 damage-inducible protein CinA (Pseudomonas simiae WCS417)
MKEITQLAAELGRRLQVLNAHVTTAESCTGGGIAEAITRIPGSSAWFEAGYVTYSNRQKT
RQLNVPEMLFSKVGAVSREVVEAMVRGAQEKSLARFAVAVSGVAGPDGGSPDKPVGTVWL
AFGVGEDVTAEVEHFTGNRDEVRRQTVKAALEGLLRRAAAEIENQG