Protein Info for GFF1142 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Single-stranded DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 TIGR00621: single-stranded DNA-binding protein" amino acids 3 to 172 (170 residues), 189.6 bits, see alignment E=2.7e-60 PF00436: SSB" amino acids 6 to 112 (107 residues), 135.4 bits, see alignment E=3.5e-44

Best Hits

Swiss-Prot: 100% identical to SSB2_SALTY: Single-stranded DNA-binding protein 2 (ssb2) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03111, single-strand DNA-binding protein (inferred from 100% identity to stm:PSLT066)

Predicted SEED Role

"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (172 amino acids)

>GFF1142 Single-stranded DNA-binding protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAARGVNKVILVGHIGQDPEVRYMPNGGAVANLTLATSETWRVRQDGEMREHTEWHRVVV
FGKLAEIASEYLRKGAQVYIEGQLRTRKWTDQSGQDKYTTEVIVNVGGTMQMLGRHNSQP
QQEPQTPPTAAKGEGKAVKGAGNAAKGKNAAAPQQPPAQPDPAYDFDDDIPF