Protein Info for GFF1134 in Methylophilus sp. DMC18

Annotation: Protein DrgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 54% identical to DRGA_SYNY3: Protein DrgA (drgA) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 75% identity to meh:M301_1132)

Predicted SEED Role

"Oxygen-insensitive NAD(P)H nitroreductase (EC 1.-.-.-) / Dihydropteridine reductase (EC 1.5.1.34)" in subsystem Pterin biosynthesis (EC 1.-.-.-, EC 1.5.1.34)

MetaCyc Pathways

tetrahydropteridine recycling (2/2 steps found)
L-phenylalanine degradation V (2/3 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.5.1.34

Use Curated BLAST to search for 1.-.-.- or 1.5.1.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>GFF1134 Protein DrgA (Methylophilus sp. DMC18)
MNVSQAIEQRRSIKAYDPAHRMTEAEIQQLLSLAMLSPTAFNIQHWRFVVVTDPVLRHQI
RAVSWNQAQVTDASLLIILTADLKAWEKDPARYWVNAPQPVSDYLVKAIHGYYTDQPLAQ
RDEGMRSCGMAAMTLMLAAKEIGYDTCPMDGFDFEAVSKLINLPEDHVPVMFVVVGKALE
AAKPRGGQLAMDEVVIYNRF