Protein Info for GFF1131 in Variovorax sp. SCN45

Annotation: putative fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 50 (18 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 272 to 286 (15 residues), see Phobius details PF00487: FA_desaturase" amino acids 27 to 262 (236 residues), 73.2 bits, see alignment E=1.5e-24

Best Hits

KEGG orthology group: None (inferred from 91% identity to vpe:Varpa_2528)

Predicted SEED Role

"putative fatty acid desaturase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>GFF1131 putative fatty acid desaturase (Variovorax sp. SCN45)
MPRLRHWRDWQSLVYLAALPALAAWQWVHGFNVAMYALMLFLTLGIGVIHHNHVHLRMWR
GRRLNRLTDFWITLLQGHPTFVFWPAHVANHHRHRHGPKDVARTYRFGGDTNHLWGYLLH
PFQAVWVLMPVFFGWLARLRRHQRGAWRYCMAQYALWLGSWALLLAIDWRKALLFVIVPQ
LHGLHWLLATNYLQHAHADGRKPARTGAPGDTPGSRLNYARNFEGLVNPLLFNIGLHTAH
HENPHAHWSELTHLHSARYRAQVDPVLNEGGLVPYMVRVFVLGAVWPRFRSRSLMPPDSS
TH