Protein Info for GFF113 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 35 to 62 (28 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 129 to 146 (18 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details PF00892: EamA" amino acids 14 to 146 (133 residues), 53.6 bits, see alignment E=1.5e-18 amino acids 155 to 280 (126 residues), 40.6 bits, see alignment E=1.5e-14

Best Hits

KEGG orthology group: None (inferred from 63% identity to vap:Vapar_4022)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>GFF113 Membrane protein, putative (Hydrogenophaga sp. GW460-11-11-14-LB1)
MVAAARHTPAQAALGIGFLILATACFAVLDTSVKYVGAFVPVLMAVWFRYLFHAVLVTAV
MLPVRGRGLVRTEHPRFQLLRGALLLTVSALSFIALQYMPVGEFTAIVMITPLVVTLLAA
LFLRERVSLLRWVLVVGGFAGALLVVQPGGDVIGWASLLPLVMVFTYAWFQILTSKMART
EDPMTMHFYTGWVGALVSSLVLPVVWQTIPDGATFALLCLIGLMGTVGHFLLILAFQRTP
ASTLTPYLYGQIGFAMFCGWLVFGHVPGRWELIGIAMIVLCGATASWLTARDRRLPVEAH
PPE