Protein Info for GFF1127 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Cobalt-zinc-cadmium resistance protein CzcD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 45 to 64 (20 residues), see Phobius details amino acids 76 to 93 (18 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 223 to 223 (1 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 40 to 331 (292 residues), 224.8 bits, see alignment E=6.7e-71 PF01545: Cation_efflux" amino acids 45 to 255 (211 residues), 125.3 bits, see alignment E=1.3e-40

Best Hits

KEGG orthology group: None (inferred from 72% identity to tmz:Tmz1t_2726)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>GFF1127 Cobalt-zinc-cadmium resistance protein CzcD (Hydrogenophaga sp. GW460-11-11-14-LB1)
LPPPSWGTDSLNNPPPTMKTDDLSPWQHHHVFDQSNPMAERGTRAVMLITAVAMVVEIVA
GWWFNSMALLADGWHMSSHTVAIGVSAFAYAAARRYARDPRFAFGTWKIEVLGGFASAIF
LLGVAVFMVVASMERMFSPQPIQYQEAIAVAVLGLIVNVVCAVILGKAHHHGHGHDDHHG
HGGGHAHEASTDLNLKSAYLHVIADATTSVLAIVALVGGWVYGWSWLDPVMGIVGAVLVA
YWAKGLMAETSRVLLDREMDHPVVDEIREAIEGGSAEYVTRLTDLHVWRVGKQAFACALS
VVTDDRDLSPQQLRERVGVHEEIVHATIEIHYSAEKRVAAPHGI