Protein Info for GFF1126 in Methylophilus sp. DMC18

Annotation: Hypoxanthine-guanine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 48 to 65 (18 residues), see Phobius details PF00156: Pribosyltran" amino acids 31 to 165 (135 residues), 76.6 bits, see alignment E=7e-26

Best Hits

KEGG orthology group: None (inferred from 75% identity to rcu:RCOM_1925940)

Predicted SEED Role

"Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)" in subsystem Purine conversions (EC 2.4.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>GFF1126 Hypoxanthine-guanine phosphoribosyltransferase (Methylophilus sp. DMC18)
MVAPQDQPPAHWLAQSQVVFTAEEVNAAMERVALQLQQRMQDLASESIVLLCVMRGGLYL
AGQLMARLNLPARIDYLQANRYHGTAGHEIVWSKQPELDLRDQTVLIVDDILDEGITLAE
VVRFCHAAGARHVLTAVLTEKDNGLQKPLQADVVGLVVPNRYVFGCGMDVYGWWRNLPEI
RALI