Protein Info for GFF1124 in Xanthobacter sp. DMC5

Annotation: Pseudopaline exporter CntI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 98 to 115 (18 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details PF00892: EamA" amino acids 6 to 138 (133 residues), 62.5 bits, see alignment E=2.7e-21 amino acids 155 to 284 (130 residues), 43.5 bits, see alignment E=2e-15

Best Hits

KEGG orthology group: None (inferred from 76% identity to xau:Xaut_3544)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>GFF1124 Pseudopaline exporter CntI (Xanthobacter sp. DMC5)
MNAPAGIALQISATFFFAIMSALVRFVADDVPSGQVVFARSAFGLIPLVIWLLWKRRMTS
ALVTRQPLGHVVRGLVGVSAMWLSFAALAFIPLAEAVAFTYVTPLVAVLLAAILLGERVP
AYRWAVLGVGFAGILLMLWPSFTHASLGSGPGPLIGAAMALLGAVIAGLAVTQVRHLTRT
ETSEAIVFYFSIVASLAGLATLPLGWVVPDLSTSLVLIATGVAGGLGQILMTTATRYAPA
SVVAPLNYATLIWATLFGVLAFGEWPDSLVLIGAGAVVSAGLVLVWRERHGLRASTLPQT
GLSGEAAKLVPVISQPTRPDDPAVARPEDYDEEDEGGQELPARRASSR