Protein Info for GFF1123 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Probable NreB protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 46 to 69 (24 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details amino acids 369 to 389 (21 residues), see Phobius details PF07690: MFS_1" amino acids 13 to 188 (176 residues), 41.5 bits, see alignment E=4.1e-15 amino acids 219 to 395 (177 residues), 56.3 bits, see alignment E=1.4e-19

Best Hits

KEGG orthology group: K07785, MFS transporter, NRE family, putaive nickel resistance protein (inferred from 72% identity to par:Psyc_1582)

Predicted SEED Role

"Probable NreB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>GFF1123 Probable NreB protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLDILGHRTYRQLFAAQVIALLGTGLATVALGLLAFDLAGDDAGVVLGTALAIKMAAYVG
VAPVAAAFVNSFPRRAVLVSLNLVRAAVALLLPFVTQIWQVYVLIFVLQSASAAFTPTFQ
ATIPDVLLAEKDYTKALSLSRLAYDMESLVSPMLAAALLTVIDFHDLFAGTVVGFLASAA
LVFSVALPKNLALERRSIYDRTTRGLRIFLATPRLRGLLAINAVVAAAGSMVFVNTVVIV
QADMGLTQTSVALALALFGAGSMVAALGLPRLLDRLSDRVAMLAGAALLVVGLGVGTQVA
SFTGTLMLWFVLGLGYSTAQTPSGRLLRRSAQPEDRPALFAAQFALSHACWLIFYPLAGW
LGARLGIPLTYAGLGLAALMAVLLALRIWPAHDPDMIEHEHANLPAGNAHLHDGVPAEKG
LRRAHPYVVDDHHPRWPGRGG