Protein Info for GFF1121 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Alpha-xylosidase (EC 3.2.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 679 PF13802: Gal_mutarotas_2" amino acids 24 to 193 (170 residues), 34.8 bits, see alignment E=3.2e-12 PF01055: Glyco_hydro_31_2nd" amino acids 238 to 575 (338 residues), 260.6 bits, see alignment E=3.5e-81 PF21365: Glyco_hydro_31_3rd" amino acids 587 to 670 (84 residues), 98 bits, see alignment E=5.6e-32

Best Hits

KEGG orthology group: K01811, putative family 31 glucosidase (inferred from 100% identity to sea:SeAg_B0046)

Predicted SEED Role

"Alpha-xylosidase (EC 3.2.1.-)" in subsystem Xylose utilization (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (679 amino acids)

>GFF1121 Alpha-xylosidase (EC 3.2.1.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MPFMQQDPRRLVWQQNDRYLWIEPWGENSLRVRSGRHLPVMRNEDWALTEPVAESQCHID
YEHHQATLTNGKIIAIVNQKGQVTFYRHPHKPLLQEFWRLRGEIGEDESSHGQYVSALNL
EGREFRPIQGGKYSLKARFEATEGEKIYGMGQYQQANLDLKGCVLELAQRNSQASVPFML
SSLGYGFLWNNPAVGRVTFAQNVTEWEAQVSEQLDYWITAGDTPAEISRAYALATGTPPM
MPDYAMGFWQCKLRYRTQEELLEVAREYKRRNLPISVIVIDFFHWPNQGDWMFDARDWPD
PDAMIAELKSLGIELMVSVWPTVDNRTESYREMRENGWLVQTERGLPINMDFLGNTTYFD
ATHPGARDYVWGKAKRNYYDKGVKLFWLDEAEPEFSVYDYDNYRYHAGPVLEVGNIYPRM
YAKTFFDGMKADGEDQVINLLRCAWAGSQKYGALVWSGDIHSSFRSLRNQFAAGLNMGIA
GIPWWTTDIGGFHGGNIHDPKFHELLIRWFQWGVFSPVMRLHGNRDPQILPAQPYRDGIA
QCPTGAPNEVWSYGEEVCEVLTGCLALREKLKPYIKALMEETHKHNTPVMRPLFFEFPEQ
ETSWTITDQYCFGPDLLIAPVMHEGMRERDVWLPEGETWTDLATGESYSGGQTLQYATPL
NRIPVFIREGGQYRSLLNL