Protein Info for GFF112 in Pseudomonas sp. DMC3

Annotation: Carnitine monooxygenase oxygenase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 PF00355: Rieske" amino acids 56 to 131 (76 residues), 59.1 bits, see alignment E=3.3e-20 PF00848: Ring_hydroxyl_A" amino acids 189 to 412 (224 residues), 127.2 bits, see alignment E=8.7e-41

Best Hits

KEGG orthology group: K00479, Rieske 2Fe-2S family protein (inferred from 98% identity to pfo:Pfl01_5216)

MetaCyc: 87% identical to glycine betaine monooxygenase catalytic subunit (Pseudomonas aeruginosa)
RXN-22705 [EC: 1.14.13.251]

Predicted SEED Role

"GbcA Glycine betaine demethylase subunit A" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.251

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>GFF112 Carnitine monooxygenase oxygenase subunit (Pseudomonas sp. DMC3)
MDVTAKISLGDPLEPARKATAQMLQERERTFSLPQPFYSDERLFDIDMQEIFQKEWLIAG
MTCEIPAKGNYLTLQVGKNPIIVIRGAEGVVHAFHNVCRHRGSRLCTSDKGKVAKLVCHY
HQWTYELDGRLLFAGTEMGADFDMKQYGLKPVNVKTAGGYIFISLAENPPAIDDFLSTLN
HYMEPYDMENTKVAITTTLMEKANWKLVLENNRECYHCNASHPELLKTLLEWDDVTDPRA
DQAFKDHVAASAAAWEAEKIPYAHASFGLRNRIVRMPLLKGTVSMTLDGKQGCAKLMGRI
KNPDLGSMRILHLPHSWNHCMGDHIIVFTVWPISAQETMVTTKWLVHKDAVEGVDYDVER
MRQVWDATNDQDRRLAEENQRGINSTAYQPGPYSKTYEFGVVNFVDWYSERMLNNLGAEP
APYLKGVPVQG