Protein Info for GFF112 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 2-keto-3-deoxygluconate permease (KDG permease)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 71 to 96 (26 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 244 to 267 (24 residues), see Phobius details amino acids 279 to 303 (25 residues), see Phobius details PF03812: KdgT" amino acids 3 to 306 (304 residues), 417.7 bits, see alignment E=1.6e-129

Best Hits

Swiss-Prot: 100% identical to KDGT1_SALTY: 2-keto-3-deoxygluconate permease 1 (kdgT1) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02526, 2-keto-3-deoxygluconate permease (inferred from 99% identity to spq:SPAB_00200)

Predicted SEED Role

"2-keto-3-deoxygluconate permease (KDG permease)" in subsystem D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>GFF112 2-keto-3-deoxygluconate permease (KDG permease) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNIKKAIERVPGGMMVVPLVIGAVINTFAPQALEIGGFTTALFKNGAAPLIGAFLLCMGA
GISVKAAPQALLQGGTITLTKLLVAIGIGLGVEHLFGAEGIFGLSGVAIIAAMSNSNGGL
YAALVGEFGNERDVGAISILSLNDGPFFTMIALGAAGMANIPIMALVAVLVPLVVGMILG
NLDPHMRDFLTKGGPLLIPFFAFALGAGINLEMLLQGGLAGILLGVLTTFVGGFFNIRAD
RLVGGTGIAGAAASSTAGNAVATPLAIAQADPSLAEVAAAAAPLIAASVITTAILTPVLT
SWVAKKQARQASLEKNA