Protein Info for GFF1116 in Variovorax sp. SCN45

Annotation: Membrane-bound lytic murein transglycosylase D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01464: SLT" amino acids 122 to 224 (103 residues), 96.2 bits, see alignment E=1e-31 PF01476: LysM" amino acids 358 to 389 (32 residues), 15.2 bits, see alignment (E = 1.7e-06) amino acids 427 to 452 (26 residues), 12.7 bits, see alignment (E = 1e-05)

Best Hits

KEGG orthology group: K08307, membrane-bound lytic murein transglycosylase D [EC: 3.2.1.-] (inferred from 86% identity to vpe:Varpa_2513)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase D precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (530 amino acids)

>GFF1116 Membrane-bound lytic murein transglycosylase D (Variovorax sp. SCN45)
MKLIAATCLAGSLVLAGCAGTNNSSAPSSSSPNAGATAGGSASPVYPRDALSPLATSQAH
SQSVVTLAPPADMWDRIRRGFKMPNLDNDLVRDREQWYASRPDYIQRMTERSNKYIFHIV
EELERRNMPTELALLPYIESAFNPQAISSARAAGMWQFMPATGTDFDLKQNIFRDDRRDV
VASTRAALDYLQKLYGMFGDWQLALAAYNWGEGSVSRAIAKNQRLGLPTTYSDLTMPAET
RMYVPKLQAVKNIVANPQAFNTELPLIANHPYFQTVTLTRDLDVELAAKLADVRLEDFRA
LNPAAHKPVLIAAGTPQILLPWDNAAVFQRNFDAYSQGQYASWTAWVVPNTMTVADAAQR
SGMSEADLRAINNVPPRMLIKAGSTLLVPRGARVKEDVAAVVADDGHLSFQPEIVTRRTT
VKAGRADSVATIARRYNLKPNNVAEWNDVKPNHAFKRGYSVVVYLPIRATVASRVGTGIP
PARGHAVASSKHATAKAGAPRGANIAKVPASSKQQVVREKRGGTPAKKKR