Protein Info for GFF1115 in Variovorax sp. SCN45

Annotation: Putative transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 42 to 42 (1 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details amino acids 343 to 379 (37 residues), see Phobius details PF06772: LtrA" amino acids 19 to 378 (360 residues), 323.4 bits, see alignment E=1e-100

Best Hits

KEGG orthology group: None (inferred from 54% identity to bid:Bind_1086)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>GFF1115 Putative transmembrane protein (Variovorax sp. SCN45)
MSHDNKRATTLRSRSEAARVSNEELFFDLVYAFSVTQLSHYLLDHLTLLGALQTLVMWFA
VWLGWQYTAWTTNWFNPGTLRIRGVLFAIMLLAMVMASALPGAFAERGLVFALCFVGIQA
GRTLCMLIAIGPNDPLTPNFRRLLAWNCVAGVFWIAGGFAQGEARLALWLGGVLCEYIAP
MIGLRFPGLGRSLTSDWTIDGGHLAERCQLFVIVALGESVLATGIAFGHHAEWHGPDLFA
LMVGFSGSLAMWWMYFDTSAKEATHAIEHSTDPGGIGAKFHYTHVILVAGIIVCAVADEL
TINEGSHHAELKYLGALVGGPALYLFGNALFKRVVRGFLPQSHLYGLGLLAVLAFFAPHL
SVIVVGTLTTLVMIAVAALEAVVRRRAWAAEPTH