Protein Info for GFF1114 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG01200701: possible membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF03502: Channel_Tsx" amino acids 102 to 253 (152 residues), 67.1 bits, see alignment E=1.2e-22

Best Hits

KEGG orthology group: None (inferred from 99% identity to sew:SeSA_A0038)

Predicted SEED Role

"FIG01200701: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>GFF1114 FIG01200701: possible membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKNKKYINSLLAACVLFSCFNGQAAELKRVYGKLSFGYGDWNKGFVNVDRGEVWKAVADF
GAVFDRGEFASFYEMNVLNHPVEGRNHVTQFLGHYRVVEGSNFTAMMKLYMSMENKFGDE
LNMMYGVGYLGLTSPSGFIKPYFAVHNLSNDYTSKKYGQATGFNGYVLGWVAAYNFDMFN
EKFVISNWNEVEMDRNDAYAEQQGGTTGLNGAVTFTWKFMPRWTASVSYRYFNNKLGYDG
YGDRMNYLIGFEF