Protein Info for PS417_05645 in Pseudomonas simiae WCS417
Annotation: LuxR family transcriptional regulator
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 61% identical to BVGA_BORPE: Virulence factors putative positive transcription regulator BvgA (bvgA) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
KEGG orthology group: K07690, two-component system, NarL family, response regulator EvgA (inferred from 100% identity to pfs:PFLU1157)Predicted SEED Role
"DNA-binding response regulator, LuxR family"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7UDN0 at UniProt or InterPro
Protein Sequence (210 amino acids)
>PS417_05645 LuxR family transcriptional regulator (Pseudomonas simiae WCS417) MNKVLIVDDHPVIRLAVRMLMERHGYEVVAETDNGVDALQLAREHMPDIVILDIGIPKLD GLEVICRLSSTKQPAPFKVLVLTSQAPGHFSMRCMQAGAAGYVCKQQDLTELLSAIKAVL SGYSYFPNQALNSVRSTMGNASEADMVERLSGREMMVLQQLARGRTNKEIADGMFLSNKT VSTYKTRLLLKLNARSLVDLIELAQRNGLV