Protein Info for GFF1113 in Variovorax sp. SCN45

Annotation: ABC transporter, ATP-binding protein (cluster 1, maltose/g3p/polyamine/iron); ABC transporter, ATP-binding protein (cluster 10, nitrate/sulfonate/bicarbonate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF00005: ABC_tran" amino acids 30 to 167 (138 residues), 101.5 bits, see alignment E=6.4e-33

Best Hits

Swiss-Prot: 40% identical to TAUB_RHIL3: Taurine import ATP-binding protein TauB (tauB) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 92% identity to vap:Vapar_2335)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>GFF1113 ABC transporter, ATP-binding protein (cluster 1, maltose/g3p/polyamine/iron); ABC transporter, ATP-binding protein (cluster 10, nitrate/sulfonate/bicarbonate) (Variovorax sp. SCN45)
MSDHALELLSISCTFHSKDDPGQRYTAVADTTLRIRAGEFVSVVGPTGCGKSTLLNVGAG
LLEPSSGTVKVFGKTLEGVNARAGYMFQTEALMPWRSAIDNVMVGLQYRGVPDADARRQA
EAWLARVGLAGFGDRYPHQLSGGMRKRVALAQTLVLDPDIILMDEPFSALDIQTRQLMEN
EVLDLWSAKKKAVLFITHDLDEAIAMSDRVVVLSAGPATHPIGEFAIDLARPRDVAEVRT
QPRFVELHTQIWEVLRDEVLKGYAQQLRKAA