Protein Info for GFF1108 in Xanthobacter sp. DMC5

Annotation: GDP-L-fucose synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF04321: RmlD_sub_bind" amino acids 11 to 70 (60 residues), 31.6 bits, see alignment E=1.4e-11 PF01370: Epimerase" amino acids 13 to 242 (230 residues), 209 bits, see alignment E=1.1e-65 PF16363: GDP_Man_Dehyd" amino acids 43 to 266 (224 residues), 62.8 bits, see alignment E=5.9e-21

Best Hits

Swiss-Prot: 62% identical to FCL_SINFN: GDP-L-fucose synthase (fcl) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02377, GDP-L-fucose synthase [EC: 1.1.1.271] (inferred from 67% identity to rec:RHECIAT_CH0000850)

MetaCyc: 57% identical to GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase (Arabidopsis thaliana col)
GDP-L-fucose synthase. [EC: 1.1.1.271]

Predicted SEED Role

"GDP-L-fucose synthetase (EC 1.1.1.271)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 1.1.1.271)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.271

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>GFF1108 GDP-L-fucose synthase (Xanthobacter sp. DMC5)
MRMVYGLAGKRVWVAGHQGMVGSAIMRRLAREDCILISAARSELDLKDQAAVRAFVERER
PQAVFLAAAKVGGILANDTFPADFLYDNLMIEANVVEASFRCGVEKLLVLGSSCVYPRLA
PQPMNEDALLTGPLEPTHEWYAVAKIAGIKLAQAYRRQHGCDFISALPTNLYGPGDNFDP
ATSHVMAALIRKAHEAKVRGDRQLVVWGTGTPRREFLHVDDCADALVLLMRAYSGPAPVN
VGSGTDETILDIARMVCASVGFEGEIVQDTSKPDGPPRKLMSNDRLRDLGWAPAIGLPEG
IAHTYAAFLDELVGA