Protein Info for PS417_05595 in Pseudomonas simiae WCS417

Annotation: ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 TIGR00658: ornithine carbamoyltransferase" amino acids 4 to 299 (296 residues), 380 bits, see alignment E=3.9e-118 PF02729: OTCace_N" amino acids 4 to 144 (141 residues), 157.5 bits, see alignment E=2.7e-50 PF00185: OTCace" amino acids 150 to 297 (148 residues), 180 bits, see alignment E=3.4e-57

Best Hits

Swiss-Prot: 87% identical to OTC_PSESM: Ornithine carbamoyltransferase (argF) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K00611, ornithine carbamoyltransferase [EC: 2.1.3.3] (inferred from 94% identity to pfs:PFLU1146)

MetaCyc: 38% identical to ornithine carbamoyltransferase ArgI (Escherichia coli K-12 substr. MG1655)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.3.3

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TDC2 at UniProt or InterPro

Protein Sequence (306 amino acids)

>PS417_05595 ornithine carbamoyltransferase (Pseudomonas simiae WCS417)
MSARHFLSLMDCTPEELVSVIRRGIELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRVSF
EAGMIQLGGQAIFLSSRDTQLGRGEPIADSAKVMSSMLDAVMIRTFAHSTVTEFSANSRV
PVINGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFQLRV
ACPEGYEPDARFLAQAGDRVTLVRDPRDAVIGAHLVSTDVWTSMGQEDETAKRLALFAPY
QVTRALLDLAAPDVLFMHCLPAHRGEEISTDLLDDPRSVAWDQAENRLHAQKALLEFLVP
PSYHHA