Protein Info for GFF1094 in Variovorax sp. SCN45

Annotation: Phosphate ABC transporter, permease protein PstA (TC 3.A.1.7.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 81 to 108 (28 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 154 to 170 (17 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 29 to 293 (265 residues), 293.5 bits, see alignment E=6.5e-92 PF00528: BPD_transp_1" amino acids 102 to 291 (190 residues), 84.6 bits, see alignment E=3.6e-28

Best Hits

Swiss-Prot: 67% identical to PSTA_ECOLI: Phosphate transport system permease protein PstA (pstA) from Escherichia coli (strain K12)

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 95% identity to vpe:Varpa_2491)

MetaCyc: 67% identical to phosphate ABC transporter membrane subunit PstA (Escherichia coli)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>GFF1094 Phosphate ABC transporter, permease protein PstA (TC 3.A.1.7.1) (Variovorax sp. SCN45)
VSTTAQNLLSAKALAEMRQAKFASRNRVNKIALTLSLAAMAFGVFWLVWILWETLRQGVG
GLAIATFTEMTPPPNEAGGIANAIFGSFVMVMLATFVGTPIGIMAGIYLAEYNPKGWLAS
ITRFVNDILLSAPSIVIGLFVYAVVVAYFKTFSGLAGSIALALIVIPVVIRTTENMLQLV
PPGLREAAYALGTPKWKVIISITLRAARAGVVTGVLLAVARIAGETAPLLFTALNNQFWT
ADVSQPMASLPVTIFKFAMSPYENWQQLAWAGVFLITVAVLALNILARVLTRNKH