Protein Info for GFF1093 in Xanthobacter sp. DMC5

Annotation: Cytochrome c biogenesis ATP-binding export protein CcmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 TIGR01189: heme ABC exporter, ATP-binding protein CcmA" amino acids 8 to 202 (195 residues), 225.1 bits, see alignment E=3.3e-71 PF00005: ABC_tran" amino acids 23 to 160 (138 residues), 97.2 bits, see alignment E=1.3e-31

Best Hits

Swiss-Prot: 55% identical to CCMA_NITWN: Cytochrome c biogenesis ATP-binding export protein CcmA (ccmA) from Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)

KEGG orthology group: K02193, heme exporter protein A [EC: 3.6.3.41] (inferred from 81% identity to xau:Xaut_3853)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA" in subsystem Biogenesis of c-type cytochromes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>GFF1093 Cytochrome c biogenesis ATP-binding export protein CcmA (Xanthobacter sp. DMC5)
MTVKALVGDNLSCRRGFKLLFEGLAVSAAAGRALVVVGPNGAGKSSLLRILAGLLAPTSG
TVRLDDGSSGGGESVGEHLHYLGHEDAVKGALTVAANLAFWRTVLGGGGLQVEEALEEVG
LGGLGRLRAQVLSAGQKRRLAIARLLVAKRPVWVLDEPTTALDVKAQARFAAFGRAHLAD
GGLLIAATHAPLDLGLTDELRLGGRP