Protein Info for PS417_05535 in Pseudomonas simiae WCS417

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 PF00072: Response_reg" amino acids 14 to 122 (109 residues), 93.7 bits, see alignment E=2.9e-30 PF00158: Sigma54_activat" amino acids 153 to 319 (167 residues), 230.4 bits, see alignment E=3.7e-72 PF14532: Sigma54_activ_2" amino acids 154 to 324 (171 residues), 69.2 bits, see alignment E=1.7e-22 PF07728: AAA_5" amino acids 176 to 295 (120 residues), 24.9 bits, see alignment E=6.3e-09 PF25601: AAA_lid_14" amino acids 325 to 381 (57 residues), 68.3 bits, see alignment 1.5e-22 PF02954: HTH_8" amino acids 405 to 445 (41 residues), 36.7 bits, see alignment 9.7e-13

Best Hits

Swiss-Prot: 55% identical to DCTD_RHIME: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 98% identity to pfs:PFLU1134)

Predicted SEED Role

"Two component, Sigma-54 Specific, central transcriptional regulator of acidic amino acid uptake"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U7Q6 at UniProt or InterPro

Protein Sequence (449 amino acids)

>PS417_05535 Fis family transcriptional regulator (Pseudomonas simiae WCS417)
MNTDAKAIKDELTVLIVEDDPHVLLGCQQALALEDIPSVGVGSAEEALKRIGENFAGIVI
SDIRLPGIDGLELLTRLKALDKSLPVVLITGHGDISMAVGAMRNGAYDFMEKPFSPERLV
DVARRALEQRGLAREVWSLRRQLAERDSLEGRIIGRSPAMQNLRELIANVADTSANVLIE
GETGTGKELVARCLHDFSRRHAHQFVALNCGGLPENLFESEIFGHEANAFTGAGKRRIGK
IEHAHEGTLFLDEVESMPINLQIKLLRVLQERTLERLGSNQSVAVDCRVIAATKSDLDEL
SRANQFRSDLYYRLNVVTLELPPLRERREDILQLFEHFLQQSSLRFDRSVPELDNQTLSS
LMSHDWPGNVRELRNVAERFALGLPAFKKSGTSSGSQGLAFTEAVEAFERNLLNDALQRS
GGNLTQASQELGMAKTTLFDKVKKYGLSH