Protein Info for GFF1090 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Chaperone protein DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 PF00226: DnaJ" amino acids 5 to 67 (63 residues), 101.3 bits, see alignment E=5.1e-33 TIGR02349: chaperone protein DnaJ" amino acids 5 to 349 (345 residues), 477.1 bits, see alignment E=2.1e-147 PF01556: DnaJ_C" amino acids 120 to 333 (214 residues), 182.7 bits, see alignment E=9.2e-58 PF00684: DnaJ_CXXCXGXG" amino acids 147 to 207 (61 residues), 64.4 bits, see alignment E=1.9e-21 PF27439: DnaJ_C_2" amino acids 339 to 376 (38 residues), 29.9 bits, see alignment 9e-11

Best Hits

Swiss-Prot: 100% identical to DNAJ_SALTY: Chaperone protein DnaJ (dnaJ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 100% identity to see:SNSL254_A0014)

MetaCyc: 95% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>GFF1090 Chaperone protein DnaJ (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAKRDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDA
QKRAAYDQYGHAAFEQGGMGGGFGGGFNGGADFSDIFGDVFGDIFGGGRGRQRAARGADL
RYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQTCPTCHGSGQVQMRQGFF
AVQQTCPHCQGRGTLIKDPCHKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLAGEGEAGEH
GAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDGRVMLKVPSET
QTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLSEKQKQLLKDLQESFGGPTGEKNS
PRSKSFFDGVKKFFDDLTR