Protein Info for GFF109 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG004556: membrane metalloprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 97 to 124 (28 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details PF02163: Peptidase_M50" amino acids 137 to 190 (54 residues), 29.8 bits, see alignment E=1.9e-11

Best Hits

KEGG orthology group: None (inferred from 76% identity to pna:Pnap_3277)

Predicted SEED Role

"FIG004556: membrane metalloprotease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>GFF109 FIG004556: membrane metalloprotease (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDFAQIVQTVALYAIPVLFAITLHEAAHGYVARHYGDNTAEMMGRITLNPFSHIDPIGTI
AMPLLLYFATSGAFLFGYAKPVPVNFGRLRNPKRDMIWVALAGPGANLIQAIAWTVLFYV
LAALGVQEPFFLRMCEAGLVVNLVMFAFNLFPLPPLDGGRILVGLLPWKQAALVSRVEPW
GFFIVMALVISGVVGNLWLRPLMALTHSAIQVLLTPLRMLLL