Protein Info for GFF1086 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF13406: SLT_2" amino acids 44 to 341 (298 residues), 328.3 bits, see alignment E=4.2e-102 TIGR02283: lytic murein transglycosylase" amino acids 44 to 344 (301 residues), 334.6 bits, see alignment E=2.6e-104 PF01471: PG_binding_1" amino acids 363 to 418 (56 residues), 50.3 bits, see alignment 2.2e-17

Best Hits

KEGG orthology group: None (inferred from 88% identity to xau:Xaut_3846)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>GFF1086 hypothetical protein (Xanthobacter sp. DMC5)
MTDDRSRLLIGRRAFTLSLAGSAFLAGIGLLAPPVFAQQAAQPFPKWVETFRARARARGV
SDATYNKVFSGLKPDTAVYAQDRNQEEFTEQSWQYLNRRVSDWRISTGRQKAKQYSGLLD
RIEQAFGVDRRVMLGYWGMESAYGEVLSNPAHMKPIFNSLAALAWGDARRRKYWEAELLN
ALVIVERGWGTPQEMTGSWAGAMGHTQWMPEVWLNMGVDFDGDGRISPFGKPDDALAGTA
NYLVKRGKYRRGEPWGFEAKLPGNFNSDLADNKTRRPLSQWGELGLTTIEGQSLSAYDEP
ARLWLPGGPGGPALLLLHNFYAVRSYNPSSNYALAVVHLGDRVMGEGPFVASWPGGERAL
TLAEIQEVQQRLTAAGFNTGGSDGRVGADTMRAVRAFQQKAGITPADGYASIAVLNALRQ
GR