Protein Info for GFF1084 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Molybdopterin biosynthesis molybdochelatase MogA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00177: molybdenum cofactor synthesis domain
  • amino acids 4 to 147 (144 residues), 136.6 bits, E=3.1e-44
• PF00994: MoCF_biosynth
  • amino acids 8 to 146 (139 residues), 90.2 bits, E=5.2e-30

Best Hits

Swiss-Prot: 92% identical to MOG_ECOLI: Molybdopterin adenylyltransferase (mog) from Escherichia coli (strain K12)

KEGG orthology group: K03831, molybdopterin adenylyltransferase (inferred from 100% identity to sei:SPC_0008)

MetaCyc: 92% identical to molybdopterin adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-8344 [EC: 2.7.7.75]

Predicted SEED Role

"Molybdopterin biosynthesis molybdochelatase MogA"

MetaCyc Pathways

• molybdenum cofactor biosynthesis (3/3 steps found)
• bis(tungstenpterin) cofactor biosynthesis (1/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.75

Protein Sequence (196 amino acids)

>GFF1084 Molybdopterin biosynthesis molybdochelatase MogA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDTLRIGLVSISDRASSGVYQDKGIPALEEWLASALTTPFEVQRRLIPDEQEIIEQTLCE
LVDEMSCHLVLTTGGTGPARRDVTPDATLAIADREMPGFGEQMRQISLRFVPTAILSRQV
GVIRKQALILNLPGQPKSIKETLEGVKADDGSVSVPGIFASVPYCIQLLDGPYVETAPEV
VAAFRPKSARRENMSD