Protein Info for GFF1083 in Sphingobium sp. HT1-2

Annotation: 2-hydroxymuconic semialdehyde hydrolase (EC 3.7.1.9)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 98 to 117 (20 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 29 to 137 (109 residues), 37.1 bits, see alignment E=7.1e-13 PF12697: Abhydrolase_6" amino acids 31 to 228 (198 residues), 35.3 bits, see alignment E=4.7e-12 PF12146: Hydrolase_4" amino acids 31 to 134 (104 residues), 38.1 bits, see alignment E=2.7e-13 PF00326: Peptidase_S9" amino acids 99 to 245 (147 residues), 30.5 bits, see alignment E=6.4e-11

Best Hits

KEGG orthology group: None (inferred from 82% identity to sch:Sphch_2098)

Predicted SEED Role

"2-hydroxymuconic semialdehyde hydrolase (EC 3.1.1.-)" (EC 3.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-

Use Curated BLAST to search for 3.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>GFF1083 2-hydroxymuconic semialdehyde hydrolase (EC 3.7.1.9) (Sphingobium sp. HT1-2)
LNAPESSPQFLARADGLRLAYRHRPGQGPTILFLPGYMSDMEGSKALALDAWAAEQGRAM
LRLDYAGCGASEGRFEDGTLASWRDDALALIDGLTQGPLLLVGSSMGGWLALLIALARPD
RIMGLVGIAAAPDFTQWGFTDADKALLATEGRIEEPTPYGDHPYVTTLAFWQSGQAHRLL
DDAIAIDCPVRLLQGQCDTDVPWEIALRTADRLRSSDVQALLIKDGDHRLSRDGDIALLI
RTVAALLDNR