Protein Info for PS417_05485 in Pseudomonas simiae WCS417

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 59 to 79 (21 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details PF00892: EamA" amino acids 61 to 128 (68 residues), 28.7 bits, see alignment E=6.5e-11

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfs:PFLU1124)

Predicted SEED Role

"Permeases of the drug/metabolite transporter (DMT) superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U7P7 at UniProt or InterPro

Protein Sequence (134 amino acids)

>PS417_05485 transporter (Pseudomonas simiae WCS417)
MSTQTMNNGWLHGRFGTVVLWALLICTESAGQLFTKVAGDQLGQMDLSWQWLADVARNPG
IVAAIASYIGAFFVWMLILRRSSLSLAFPLSSLVFVVVLLGSWLGLGEHISPLHWVGVAV
IIGGIALLAEGEEN