Protein Info for GFF1072 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative fimbrial chaperone protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00345: PapD_N
  • amino acids 21 to 139 (119 residues), 130.9 bits, E=2.6e-42
• PF02753: PapD_C
  • amino acids 162 to 217 (56 residues), 59.1 bits, E=4.4e-20

Best Hits

Swiss-Prot: 34% identical to FIMC_ECOLI: Chaperone protein FimC (fimC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to sty:STY4943)

Predicted SEED Role

"Putative fimbrial chaperone protein"

Protein Sequence (227 amino acids)

>GFF1072 Putative fimbrial chaperone protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKHIKKSVLAVLLTSHVAHASIVVGGTRLVFDGNNDESSINVENKDSKANLVQSWLSVAD
PQVTNKQAFIITPPLFRLDAGQKNSIRVIRSGAPLPADRESMYWLNIKGIPSIDDNASAN
RVEISINTQIKLIYRPPALTKSTPDSQSQQLKWQTAGDVITVNNPTPYYMNFASVTLNSH
EVKSATFVPPKSSASFKLGSTAAPHGTVTWRLISDYGMSLEPHSGSF