Protein Info for GFF1071 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: type 1 fimbriae anchoring protein FimD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 809 PF13954: PapC_N" amino acids 7 to 141 (135 residues), 134.6 bits, see alignment E=4e-43 PF00577: Usher" amino acids 158 to 717 (560 residues), 626.1 bits, see alignment E=1e-191 PF13953: PapC_C" amino acids 727 to 793 (67 residues), 70.3 bits, see alignment E=1.5e-23

Best Hits

KEGG orthology group: K07347, outer membrane usher protein (inferred from 100% identity to stm:STM4593)

Predicted SEED Role

"type 1 fimbriae anchoring protein FimD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (809 amino acids)

>GFF1071 type 1 fimbriae anchoring protein FimD (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
LENDEPGVENVDLSVFEKGGQAEGTYNVDIYINNTSVETKNIAFKNKKSADNKLSLQPCL
SVEQLKQWGVKTENFPELKNDPNGCTDLSLLAGAVAKFNVIGNRLDLAIPQIALIADPRE
FVPTSEWDEGINAFLLNYSFTGSQDHDIDENRTENSEYANLRPGINIGAWRFRNYSTWNH
DSDGQNSWDSAYTYVSRDIEFLKGQLIAGENNTPADVFDSISFKGVQISSDDDMLPDSMK
GFAPVIRGVAKSSAQVTVEQNGYTIYKTNVPAGPFAINDLYPTGGSGDLYVTIKESDGSE
QHFIVPYASVPVLQREGHLKYDLTVGRTRSSDTHSAQQNFAELTALYGLAGGITAYGGIE
STLSNDVYHAALIGTGLNLGDLGALSLDVTNSWSKIKAGDVVSDTLTGQSWRIRYSKDIQ
STGTNFTVAGYRYSTKDYYALEDVLDTYSDNSHYDHVRNRTDLSLSQDIIYGSISLTLYN
EDYWNDTHTTSLGIGYNNTWHNVSYGINYSYTLNADNSQDEDDDTEDSNDQQISINISIP
LDAFMPSTYATYNMNSAKDGDTTHTVGLNGTALAQKNLSWSVQEGYSSQEKATSGNVSAT
YNGTYADINGGYSYDNHMRRLNYGVQVGVLLHRNGLTLSQPMDDTIILVKAPGAAGVPVN
NETGVDTDFRGYAVVPYASPYHRNEVSLDTTGIRKNIELIDTSKTLVPTRGAVVRAEYKT
NIGYKALMVLTRINNLPVPFGATVSSLTKPDNHSSFVGDAGQAWLTGLEKQGRLLVKWGP
TAADQCQVSYRIPSSPSASGVEILHEQCQ